-SDS.jpg)
- Home
- Protein
- Transmembrane Protein
- Recombinant Human Tumor necrosis factor receptor superfamily member 6(FAS)
Recombinant Human Tumor necrosis factor receptor superfamily member 6(FAS)
Code | CSB-CF008433HU(A4) |
Size | US$3401 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
- Product Details
- RelatedProducts
- Customer Reviews and Q&A
- Target Data
Product Details
Purity | Greater than 85% as determined by SDS-PAGE. |
Target Names | FAS |
Uniprot No. | P25445 |
Research Area | Cell Biology |
Alternative Names | ALPS 1A; ALPS1A; APO 1; Apo 1 antigen; APO 1 cell surface antigen; Apo-1 antigen; APO1; Apo1 antigen; APO1 cell surface antigen; Apoptosis antigen 1; Apoptosis mediating surface antigen FAS; Apoptosis-mediating surface antigen FAS; APT 1; APT1; CD 95; CD 95 antigen; CD95; CD95 antigen ; Delta Fas; Delta Fas/APO 1/CD95; Delta Fas/APO1/CD95; Fas (TNF receptor superfamily; member 6); FAS 1; FAS 827dupA; Fas AMA; Fas; FAS Antigen; Fas cell surface death receptor; FAS1; FASLG receptor; FASTM; sFAS; Surface antigen APO1; TNF receptor superfamily; member 6; TNFRSF 6; TNFRSF6; TNR6_HUMAN; Tumor necrosis factor receptor superfamily member 6 |
Species | Homo sapiens (Human) |
Source | in vitro E.coli expression system |
Expression Region | 26-335aa |
Target Protein Sequence | QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLVNote: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 40.6 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info | N-terminal 10xHis-tagged |
Form | Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.Note: If you have any special requirement for the glycerol content, please remark when you place the order.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs | Protein FAQs |
Storage Condition | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
Related Products
Customer Reviews and Q&A
There are currently no reviews for this product.
Submit a Review here
Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>
Regarding your protein CSB-CF008433HU, could you please provide some informations?Also, have you had any customers order this protein before?If so, could you please advise on the purity obtained?Would you be able to provide a representative COA?
QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSRSNLGWLCLLLLPIPLIVWVKRKEVQKTCRKHRKENQGSHESPTLNPETVAINLSDVDLSKYITTIAGVMTLSQVKGFVRKNGVNEAKIDEIKNDNVQDTAEQKVQLLRNWHQLHGKKEAYDTLIKDLKKANLCTLAEKIQTIILKDITSDSENSNFRNEIQSLV
In addition, below are the information about the partial protein expressed by the four regular expression systems:Recombinant Human Tumor necrosis factor receptor superfamily member 6(FAS),partialCSB-YP008433HU >> Yeast CSB-EP008433HU >> E.coli CSB-BP008433HU >> Baculovirus CSB-MP008433HU >> Mammalian cell Expression Region: 26-171aa; Partial. Tag information:EP, YP, BP, MP: Tag type will be determined during the manufacturing process. The expected tag for each expression system is listed as follows:YP: N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Sequence:QVTDINSKGLELRKTVTTVETQNLEGLHHDGQFCHKPCPPGERKARDCTVNGDEPDCVPCQEGKEYTDKAHFSSKCRRCRLCDEGHGLEVEINCTRTQNTKCRCKPNFFCNSTVCEHCDPCTKCEHGIIKECTLTSNTKCKEEGSR
Sorry, all of them are semi-custom proteins that we haven"t expressed before, so no customer ordered and the COA is not available for the time being. We can guarantee that the final purity will be more than 85%, if you have higher requirement for the purity, please also communicate with us in advance, we can try as high purity as possible, but we just can"t 100% guarantee the purity shown on the COA can reach 90% or 95%.Target Data
Function | Receptor for TNFSF6/FASLG. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. FAS-mediated apoptosis may have a role in the induction of peripheral tolerance, in the antigen-stimulated suicide of mature T-cells, or both. The secreted isoforms 2 to 6 block apoptosis (in vitro). |
Gene References into Functions |
|
Involvement in disease | Autoimmune lymphoproliferative syndrome 1A (ALPS1A) |
Subcellular Location | Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Secreted, SUBCELLULAR LOCATION: Isoform 3: Secreted, SUBCELLULAR LOCATION: Isoform 4: Secreted, SUBCELLULAR LOCATION: Isoform 5: Secreted, SUBCELLULAR LOCATION: Isoform 6: Secreted |
Tissue Specificity | Isoform 1 and isoform 6 are expressed at equal levels in resting peripheral blood mononuclear cells. After activation there is an increase in isoform 1 and decrease in the levels of isoform 6. |
Database Links | HGNC: 11920 OMIM: 134637 KEGG: hsa:355 STRING: 9606.ENSP00000347979 UniGene: Hs.244139 |